Protein Info for PP_4523 in Pseudomonas putida KT2440

Annotation: putative Agmatinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 302 to 317 (16 residues), see Phobius details TIGR01230: agmatinase" amino acids 40 to 312 (273 residues), 206.7 bits, see alignment E=2.7e-65 PF00491: Arginase" amino acids 40 to 312 (273 residues), 317.3 bits, see alignment E=4.9e-99

Best Hits

Swiss-Prot: 90% identical to GBUA_PSEAE: Guanidinobutyrase (gbuA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K12255, guanidinobutyrase [EC: 3.5.3.7] (inferred from 99% identity to pen:PSEEN3933)

MetaCyc: 100% identical to guanidinobutyrase subunit (Pseudomonas putida)
Guanidinobutyrase. [EC: 3.5.3.7]

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.3.11

Use Curated BLAST to search for 3.5.3.11 or 3.5.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EE2 at UniProt or InterPro

Protein Sequence (320 amino acids)

>PP_4523 putative Agmatinase (Pseudomonas putida KT2440)
MRPTVDKTLHQPLGGNEMPRFGGIATMLRLPHLQSAKGLDAAFIGVPLDIGTSLRSGTRF
GPRQIRAESVMIRPYNMATGAAPFDSLSVADIGDVAINTFNLLDAVRIIEEAYDEIVEHN
VIPMTLGGDHTITLPILRALHKKHGKIGLVHIDAHADVNDHMFGEKIAHGTTFRRAVEEG
LLDCDRVVQIGLRAQGYTADDFNWSRRQGFRVVQAEECWHKSLEPLMAEVREKVGGGPVY
LSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRGCHGLDLIGCDLVEVSPPYDTTGNTS
LLGANLLFEMLCVLPGVVRR