Protein Info for PP_4521 in Pseudomonas putida KT2440

Annotation: putative aerotaxis receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 transmembrane" amino acids 143 to 166 (24 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 21 to 123 (103 residues), 43.7 bits, see alignment E=1.5e-15 PF00989: PAS" amino acids 21 to 108 (88 residues), 35.2 bits, see alignment E=2.2e-12 PF13426: PAS_9" amino acids 23 to 107 (85 residues), 38.7 bits, see alignment E=2.1e-13 PF08447: PAS_3" amino acids 31 to 113 (83 residues), 58.4 bits, see alignment E=1.5e-19 PF00015: MCPsignal" amino acids 325 to 487 (163 residues), 142.7 bits, see alignment E=2.2e-45

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 100% identity to ppu:PP_4521)

Predicted SEED Role

"aerotaxis receptor, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EE4 at UniProt or InterPro

Protein Sequence (521 amino acids)

>PP_4521 putative aerotaxis receptor (Pseudomonas putida KT2440)
MRMNLPVTEHERTFPGDQRLISTTDLDSRITYCNDAFVAISGFTYDELVGQPHNLVRHPD
MPPAVFGHMWETIKQGKPWMGIVKNRAKNGDYYWVSAYVTAIYEQGRISGYESVRSVPTR
EQIRRAEALYARLRDGRSPVPWAARLGHGLGHGWPLIGAGLLSAAGYLWLPPYAALAVLM
ASLLLAWYWVEHRQNQAIRRTLAEHPKAFTSPLVALTYSDNPGLKGQLDLAIISEEARLQ
TALTRLVDAGVGVKSRAAQSSDLSDAQAQMLDRQRSETDQSATAIAQMAATIQQVTHNVQ
STAHAASDADQLAQQGSELALKSLKDMGSMSDAVNDIGQAVNALAEQTQSIGSVVDVITS
IAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRSLAQRTRASTEEIHHIIASLRAGAER
AVSTASRGEQISRDSVHSVEAVQAALSGIAVAVSRITGMSQQMATASEQQSHVAEDINQQ
IVRIAQLCDQSAGQARQGAEISQDLERMAEYLHSLAERFNR