Protein Info for PP_4519 in Pseudomonas putida KT2440

Annotation: Agglutination protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 21 to 432 (412 residues), 299.8 bits, see alignment E=1.7e-93 PF02321: OEP" amino acids 27 to 215 (189 residues), 66.9 bits, see alignment E=1.1e-22 amino acids 237 to 421 (185 residues), 93.3 bits, see alignment E=8.7e-31

Best Hits

KEGG orthology group: K03287, outer membrane factor, OMF family (inferred from 100% identity to ppf:Pput_1392)

Predicted SEED Role

"Agglutination protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EE6 at UniProt or InterPro

Protein Sequence (452 amino acids)

>PP_4519 Agglutination protein (Pseudomonas putida KT2440)
MRVLNPITSALLLALASANVQAMSITEAVQSAVDYHPQVSSNRNSKLSADEDVKFARGGY
YPSVDLVAGYGRQRSDNATTRAEGNHNKETLNYTQSELRLRQMIFDGFNTSNEVGRTEAV
STSRAYYTQAVAQDVALRAVEVYLEVLKRRELVTLAKNNLQAHLRVNDQIGLRNERGVGS
TADLDQSRARRALAENNLDTAEVDLADAEANFFSVIGRAPDELESPQSIKGEVPGTLEEA
RDGMRQNNPYIKSAQADVNAAEKQYEVGKSTFYPRFDAILATGANNNTGGEKGHNNNDWQ
AGVEMNYNLFRGGSDKARLQSDAHKINQALDIRNNALRELTENLSLAWNAMNNASKQLPT
AREYAETTKRVRAAYQDQFGLGQRTLLDVLDSENELYNADRRYTEVRYTEEFSRYRVLAT
MGELLSKQHISLPPEALATTEVRTEARLPEMR