Protein Info for PP_4496 in Pseudomonas putida KT2440

Annotation: 23S rRNA pseudouridine 2605 synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF01479: S4" amino acids 18 to 62 (45 residues), 41.1 bits, see alignment 1.2e-14 PF00849: PseudoU_synth_2" amino acids 81 to 213 (133 residues), 71.1 bits, see alignment E=1.3e-23 TIGR00093: pseudouridine synthase" amino acids 85 to 247 (163 residues), 181.7 bits, see alignment E=4.3e-58

Best Hits

Swiss-Prot: 52% identical to RLUB_VIBPA: Ribosomal large subunit pseudouridine synthase B (rluB) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K06178, ribosomal large subunit pseudouridine synthase B [EC: 5.4.99.12] (inferred from 100% identity to ppf:Pput_1416)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase B (EC 4.2.1.70)" in subsystem Two cell division clusters relating to chromosome partitioning (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FWP7 at UniProt or InterPro

Protein Sequence (355 amino acids)

>PP_4496 23S rRNA pseudouridine 2605 synthase (Pseudomonas putida KT2440)
MSEQDLKETEITPPSGEKLQKVLARIGVGSRRDVEAWISQGRIKVNGVEATLGQRVDLHD
AIAVDGKLIKREEAAEATRRVIMYNKPDGEICTRDDPEGRPTVFDRLPRPKEGRWINIGR
LDINTTGLLLFTTDGELANRLMHPSYEMDREYAVRVRGEVDDEMIERLKAGVMLEDGPAK
FTDIQKAPGGEGFNHWYHCVVMEGRNREVRRLWESQGMVVSRLKRVRFGPVFLNSDLPMG
RWREMTQGEIDILAAEVGLQPVALPAMKLKAKDKMERLQRKSTRPLGRGERVRNLRPAHE
GAATGERPARQPREEAPRKPTRGSTVAERPSEMRKRPGKPDGDKPAGRGRGKPRG