Protein Info for PP_4475 in Pseudomonas putida KT2440

Annotation: succinylglutamate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 TIGR03242: succinylglutamate desuccinylase" amino acids 6 to 327 (322 residues), 435.4 bits, see alignment E=7.1e-135 PF24827: AstE_AspA_cat" amino acids 49 to 241 (193 residues), 213.8 bits, see alignment E=1.7e-67 PF04952: AstE_AspA_hybrid" amino acids 255 to 328 (74 residues), 76.5 bits, see alignment E=1.3e-25

Best Hits

Swiss-Prot: 100% identical to ASTE_PSEPK: Succinylglutamate desuccinylase (astE) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K05526, succinylglutamate desuccinylase [EC: 3.5.1.96] (inferred from 100% identity to ppu:PP_4475)

Predicted SEED Role

"Succinylglutamate desuccinylase (EC 3.5.1.96)" in subsystem Arginine and Ornithine Degradation (EC 3.5.1.96)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.96

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EI7 at UniProt or InterPro

Protein Sequence (335 amino acids)

>PP_4475 succinylglutamate desuccinylase (Pseudomonas putida KT2440)
MLALGKLLELTLTDHEPAEKTQVTPKGARLRWLGEGALEVRPAESDDCGLDLLLSAGIHG
NETAPIELLERLLHGVANGKIRPRARVLFLFGNPAAIRKGERFIEQDINRLFNGRHELSS
GFEALRAAELEQFARVFFSKPGRNRLHYDLHTAIRGSKIEQFALYPYKEGRKHSRRELAR
LAAAGMEAVLLQSKSSITFSAFTYEQLEAEAFTLELGKARPFGQNEQVNLDKLEERLIRI
IEATEPEDESSLDGLQLFSVSREIIKHSDSFHLHLPADIENFSELSKGYLLAEDLAEMRW
VVEEEGARIIFPNPKVKNGLRAGILIVPDSGQRLG