Protein Info for PP_4432 in Pseudomonas putida KT2440

Annotation: putative Xaa-Pro aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 TIGR02993: ectoine utilization protein EutD" amino acids 6 to 396 (391 residues), 826.4 bits, see alignment E=1.9e-253 PF01321: Creatinase_N" amino acids 18 to 163 (146 residues), 66.4 bits, see alignment E=3.8e-22 PF00557: Peptidase_M24" amino acids 171 to 379 (209 residues), 116.3 bits, see alignment E=1.7e-37

Best Hits

Swiss-Prot: 66% identical to DOEA_HALED: Ectoine hydrolase (doeA) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K01271, Xaa-Pro dipeptidase [EC: 3.4.13.9] (inferred from 100% identity to ppu:PP_4432)

MetaCyc: 66% identical to ectoine hydrolase (Halomonas elongata DSM 2581)
RXN-18397 [EC: 3.5.4.44]

Predicted SEED Role

"Aminopeptidase YpdF (MP-, MA-, MS-, AP-, NP- specific)" in subsystem Protein degradation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.13.9 or 3.5.4.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EM2 at UniProt or InterPro

Protein Sequence (396 amino acids)

>PP_4432 putative Xaa-Pro aminopeptidase (Pseudomonas putida KT2440)
MSEIVVNLPFTREEYAQRIAKVRAEMQARNIELLLVTDPSNMAWLTGYDGWSFYVHQCVL
LAMEGEPVWYGRNQDANGARRTVFMKQDNIVGYPDIYVQSTERHPMDYLCKEVIQARGWD
SLTIGVELDNYYFSAAAYLALQQHLPKAKFVNANALVNWQRAVKSQQEISYMRVAARIVE
KMHDRILERIEPGMRKNELVADIYASGILGVDGYGGDYPAIVPLLPTGADASAPHLTWDD
SPFKVGAGTFFEIAGCYKRYHCPLSRTVYLGKPPQHFIDGEKAVVEGIAAGLEAAKPGNT
TGDIARAFFGVLEKFDIHKDSRCGYPIGISYPPDWGERTMSLRPSDNSVLKPGMTFHFMP
GLWMDDWGLEITESILITDTGVETFCSTPRKLFVKD