Protein Info for PP_4430 in Pseudomonas putida KT2440

Annotation: putative threonine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02991: ectoine utilization protein EutB
  • amino acids 4 to 318 (315 residues), 450.3 bits, E=1.5e-139
• PF00291: PALP
  • amino acids 18 to 306 (289 residues), 254 bits, E=9.9e-80

Best Hits

Swiss-Prot: 58% identical to Y4TJ_SINFN: Putative threonine dehydratase (NGR_a01490) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 100% identity to ppu:PP_4430)

MetaCyc: 35% identical to catabolic threonine dehydratase (Escherichia coli K-12 substr. MG1655)
Threonine ammonia-lyase. [EC: 4.3.1.19]; L-serine ammonia-lyase. [EC: 4.3.1.19, 4.3.1.17]

Predicted SEED Role

"Threonine dehydratase, catabolic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis or Glycine and Serine Utilization or Threonine anaerobic catabolism gene cluster or Threonine degradation (EC 4.3.1.19)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• glycine betaine degradation III (7/7 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-methionine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• glycine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• glycine betaine degradation I (6/8 steps found)
• D-serine degradation (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• L-threonine degradation I (4/6 steps found)
• L-threonine degradation V (1/2 steps found)
• superpathway of L-threonine metabolism (12/18 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• hypoglycin biosynthesis (4/14 steps found)
• cyclosporin A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17, 4.3.1.19

Use Curated BLAST to search for 4.3.1.17 or 4.3.1.19

Sequence Analysis Tools

See Q88EM4 at UniProt or InterPro

Protein Sequence (330 amino acids)

>PP_4430 putative threonine dehydratase (Pseudomonas putida KT2440)
MPAVTVREALIARDRIKHLVRETRMELSPSLSDFMKVPVYLKLECHQATGSFKLRGATNA
IAGLTSQQRALGVVTASTGNHGRALSYAAAAAGVRATVCLSRLVPSNKVAAIRALGAAVQ
VVGNSQDDAQFEAARLAQEEGLTFIPPFDHQDVIAGQATLGLEIAEQLPSVSQVLIPLSG
GGLFSGVSLALKALLPQVKTHGVSMRLGAAMAQSLEAGKPVNVEEVATLADSLGGGIGLR
NQYTFELTRRFIDRVILLNEDSIADAMLHAYLEERLVIEGAGAVGIAALLTRQVEAQGPI
VIVVSGGNVDMAQHQRIILEAVRDRRPARA