Protein Info for PP_4423 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR02994: ectoine utilization protein EutE" amino acids 2 to 327 (326 residues), 635.1 bits, see alignment E=9.9e-196 PF24827: AstE_AspA_cat" amino acids 48 to 234 (187 residues), 187.6 bits, see alignment E=9.1e-60

Best Hits

Swiss-Prot: 61% identical to DOEB_HALED: N-alpha-acetyl-L-2,4-diaminobutyric acid deacetylase (doeB) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K06987, (no description) (inferred from 100% identity to ppu:PP_4423)

MetaCyc: 61% identical to N2-acetyl-L-2,4-diaminobutanoate deacetylase (Halomonas elongata DSM 2581)
RXN-18396 [EC: 3.5.1.125]

Predicted SEED Role

"succinate dehydrogenase subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.125

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EN1 at UniProt or InterPro

Protein Sequence (331 amino acids)

>PP_4423 conserved protein of unknown function (Pseudomonas putida KT2440)
MKPSPIKPTIDFDQQGVSHGFLKLPYSRDDSAWGAIMIPITVMKNGIGPTVLLTGGNHGD
EYEGPIALTKLANQLDIETVRGRIIILPFMNYPAFKNASRTSPIDRGNLNRTFPGKADGT
VTEKIADYIQRHLLPLADYVLDIHSGGKTLDFIPFAAVHILPDKLQQQKGERAMDAFAAP
YSMKMLEIDSVGMFDTAVEEAGKIFVTTELGGGGTASSTTIKIAERGVRNFLVHAGAVMG
DLDIAQDSIFLDMPDDNCFIASEHAGLIEYCFNLGDQVSKGDVIARVYDVTRTGVAPTEY
KAQRDGLLACRHFPGLVQCGDTIAVLAEKIS