Protein Info for PP_4405 in Pseudomonas putida KT2440

Annotation: Sensory box protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 TIGR00229: PAS domain S-box protein" amino acids 13 to 136 (124 residues), 43.2 bits, see alignment E=4e-15 PF00989: PAS" amino acids 16 to 107 (92 residues), 23 bits, see alignment E=1.4e-08 PF13188: PAS_8" amino acids 16 to 61 (46 residues), 22.3 bits, see alignment 1.8e-08 PF08447: PAS_3" amino acids 38 to 126 (89 residues), 87.8 bits, see alignment E=9.8e-29 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 175 to 330 (156 residues), 150.2 bits, see alignment E=4.4e-48 PF00990: GGDEF" amino acids 177 to 328 (152 residues), 149 bits, see alignment E=2.1e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4405)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EP8 at UniProt or InterPro

Protein Sequence (332 amino acids)

>PP_4405 Sensory box protein (Pseudomonas putida KT2440)
MSQDTRPVPAGFSEQQLHTLFDLISDGIWDWNANTGYVYRNPGWYSMLGYASHSMANSVF
TWESVIHPEDYPRVMAHFEAYINHRNERYRIEYRCRCQDGSYIWIEDSGYIIAHNEDGSV
ARMLGAHRNIDAGKRLVSQLEQKNQSLEFQVAERTRELSWVNQQLQRQLDENRELAERDA
LTRVANRYRLESALQLECQRAQRFRQPLSLIAMDMDDFKPINDRYGHARGDAALVRVAES
LRTCLRELDLLARWGGDEFVIVLPQTALGEALDVAARLRQVLEQVEPVGDCRLTMSYGVV
QWREGEDQHALLARADKALYRAKGTGKNAIAE