Protein Info for PP_4403 in Pseudomonas putida KT2440

Annotation: Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF00364: Biotin_lipoyl" amino acids 5 to 77 (73 residues), 60 bits, see alignment E=2.4e-20 PF02817: E3_binding" amino acids 136 to 170 (35 residues), 45.9 bits, see alignment 8.1e-16 PF00198: 2-oxoacid_dh" amino acids 193 to 421 (229 residues), 270.5 bits, see alignment E=1.7e-84

Best Hits

Swiss-Prot: 97% identical to ODB2_PSEPU: Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (bkdB) from Pseudomonas putida

KEGG orthology group: K09699, 2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [EC: 2.3.1.168] (inferred from 100% identity to ppf:Pput_1451)

Predicted SEED Role

"Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC 2.3.1.168)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 2.3.1.168)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.168

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EQ0 at UniProt or InterPro

Protein Sequence (423 amino acids)

>PP_4403 Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (Pseudomonas putida KT2440)
MGTHVIKMPDIGEGIAQVELVEWFVKVGDIIAEDQVVADVMTDKATVEIPSPVSGKVLAL
GGQPGEVMAVGSELIRIEVEGSGNHVDVPQPKPVEAPAAPIAAKPEPQKDVKPAVYQAPA
NHEAAPIVPRQPGDKPLASPAVRKRALDAGIELRYVHGSGPAGRILHEDLDAFMSKPQSN
AGQAPDGYAKRTDSEQVPVIGLRRKIAQRMQDAKRRVAHFSYVEEIDVTALEALRQQLNS
KHGDSRGKLTLLPFLVRALVVALRDFPQINATYDDEAQIITRHGAVHVGIATQGDNGLMV
PVLRHAEAGSLWANAGEISRLANAARNNKASREELSGSTITLTSLGALGGIVSTPVVNTP
EVAIVGVNRMVERPVVIDGQIVVRKMMNLSSSFDHRVVDGMDAALFIQAVRGLLEQPACL
FVE