Protein Info for PP_4402 in Pseudomonas putida KT2440

Annotation: branched-chain alpha-keto acid dehydrogenase complex, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF02779: Transket_pyr" amino acids 5 to 180 (176 residues), 132.5 bits, see alignment E=1.3e-42 PF02780: Transketolase_C" amino acids 213 to 329 (117 residues), 132.5 bits, see alignment E=7.9e-43

Best Hits

Swiss-Prot: 99% identical to ODBB_PSEPU: 2-oxoisovalerate dehydrogenase subunit beta (bkdA2) from Pseudomonas putida

KEGG orthology group: K00167, 2-oxoisovalerate dehydrogenase E1 component, beta subunit [EC: 1.2.4.4] (inferred from 99% identity to ppg:PputGB1_3963)

Predicted SEED Role

"Branched-chain alpha-keto acid dehydrogenase, E1 component, beta subunit (EC 1.2.4.4)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.2.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.4

Use Curated BLAST to search for 1.2.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EQ1 at UniProt or InterPro

Protein Sequence (339 amino acids)

>PP_4402 branched-chain alpha-keto acid dehydrogenase complex, beta subunit (Pseudomonas putida KT2440)
MATTTMTMIQALRSAMDVMLERDDNVVVYGQDVGYFGGVFRCTEGLQNKYGKSRVFDAPI
SESGIVGTAVGMGAYGLRPVVEIQFADYFYPASDQIVSELARLRYRSAGEFIAPLTLRMP
CGGGIYGGQTHSQSPEAMFTQVCGLRTVMPSNPYDAKGLLIASIECDDPVIFLEPKRLYN
GPFDGHHDRPVTPWSKHPHSAVPDGYYTVPLDKAAITRPGNDVTVLTYGTTVYVAQVAAE
ESGVDAEVIDLRSLWPLDLDTIVESVKKTGRCVVVHEATRTCGFGAELVSLVQEHCFHHL
EAPIERVTGWDTPYPHAQEWAYFPGPSRVGAALKKVMEV