Protein Info for PP_4394 in Pseudomonas putida KT2440

Annotation: flagella basal body P-ring formation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF17656: ChapFlgA_N" amino acids 50 to 122 (73 residues), 63.7 bits, see alignment E=2.4e-21 TIGR03170: flagella basal body P-ring formation protein FlgA" amino acids 113 to 248 (136 residues), 143 bits, see alignment E=2.9e-46 PF08666: SAF" amino acids 126 to 187 (62 residues), 40.6 bits, see alignment E=4.5e-14 PF13144: ChapFlgA" amino acids 126 to 248 (123 residues), 129.8 bits, see alignment E=8.9e-42

Best Hits

KEGG orthology group: K02386, flagella basal body P-ring formation protein FlgA (inferred from 100% identity to ppf:Pput_1460)

Predicted SEED Role

"Flagellar basal-body P-ring formation protein FlgA" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EQ9 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PP_4394 flagella basal body P-ring formation protein (Pseudomonas putida KT2440)
MHTKTTFSRRLTRLLTGPLATLCLLMPGVRTVANAFTLPEQLIGVTQGFLEFTVEDYLST
TQTAGRYEIQVNPLDPRLRMPLCSQQLDASLESPAQPLGRVTVRIRCNGAAPWTVFVPAT
VRLFRDVVVVTRPLKRDNTVGEGDVALRERDVGTLGQGFLTELDQAVGMKMLRPTVIDQV
LTPQHLEQAEVVRKGDQVVIIARSGSLSVRMPGEALSKGGLSEQIRVRNLNSKRVVKARV
TGPGQVEVSM