Protein Info for PP_4376 in Pseudomonas putida KT2440

Annotation: flagellar filament capping protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 PF02465: FliD_N" amino acids 11 to 107 (97 residues), 84.5 bits, see alignment E=1e-27 PF07196: Flagellin_IN" amino acids 131 to 186 (56 residues), 34.6 bits, see alignment 2.6e-12 PF07195: FliD_C" amino acids 211 to 433 (223 residues), 219 bits, see alignment E=1e-68

Best Hits

KEGG orthology group: K02407, flagellar hook-associated protein 2 (inferred from 100% identity to ppu:PP_4376)

Predicted SEED Role

"Flagellar hook-associated protein FliD" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88ES7 at UniProt or InterPro

Protein Sequence (452 amino acids)

>PP_4376 flagellar filament capping protein (Pseudomonas putida KT2440)
MASTTVSGIGSGVDTQSIVKALADAEKAPKQQQITTQQKTTTTQVSAVGMIKNALDTFRS
AIAKLNTSTSFTGLAGTSSDEKVAKATVTASASAGNYALEVTQLATSSKITTDVFAGGVS
SVVNNSGDPQTLTISQSSADYNVTIPDGATLQQVRDLINKQLGSQGINANILTDAKGSRL
VMSSSTTGEGSDITLSGDSSLVQNATPGAPAQNAKYTIDGLELESKSNTVTGAISGVNFE
LLAEGKSRLSVATNTTTLKTSVQSFVSAYNALITAINTQTKVTATGDASTTTAGALTGDA
TMRALVSTVRNELVKSTGAGSISMLSQMGINTDQQTGLLVLDDTKWDKAVAKGAADIAAV
FTGDKGLIKRMTAATDAYTGTTGILATRTKNLNDNLTELTKQQEALDRRIETLTATLTAK
YNAMDTLVAKLNATSSSVMTTLNAMNKANNDD