Protein Info for PP_4370 in Pseudomonas putida KT2440

Annotation: Flagellar hook-basal body complex protein FliE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 PF02049: FliE" amino acids 32 to 110 (79 residues), 107.2 bits, see alignment E=2e-35 TIGR00205: flagellar hook-basal body complex protein FliE" amino acids 36 to 109 (74 residues), 90.1 bits, see alignment E=5.9e-30

Best Hits

Swiss-Prot: 100% identical to FLIE_PSEPK: Flagellar hook-basal body complex protein FliE (fliE) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02408, flagellar hook-basal body complex protein FliE (inferred from 100% identity to ppg:PputGB1_3931)

Predicted SEED Role

"Flagellar hook-basal body complex protein FliE" in subsystem Flagellum or Flagellum in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88ET3 at UniProt or InterPro

Protein Sequence (110 amino acids)

>PP_4370 Flagellar hook-basal body complex protein FliE (Pseudomonas putida KT2440)
MSQGVEFNRLMLDMRAMQADAMSLPKVTAAPELAPGQSTFADMLGQAIGKVHETQQASTQ
LANAFEIGKSGVDLTDVMIASQKASVSMQAMTQVRNKLVQAYQDIMQMPV