Protein Info for PP_4366 in Pseudomonas putida KT2440

Annotation: flagellum-specific ATP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR01026: ATPase, FliI/YscN family" amino acids 33 to 452 (420 residues), 566.1 bits, see alignment E=4.9e-174 TIGR03496: flagellar protein export ATPase FliI" amino acids 35 to 450 (416 residues), 637.8 bits, see alignment E=7.2e-196 PF00006: ATP-synt_ab" amino acids 161 to 372 (212 residues), 291.3 bits, see alignment E=4.7e-91 PF18269: T3SS_ATPase_C" amino acids 379 to 449 (71 residues), 79.1 bits, see alignment E=1.8e-26

Best Hits

Swiss-Prot: 87% identical to FLII_PSEAE: Flagellum-specific ATP synthase (fliI) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 99% identity to ppg:PputGB1_3927)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88ET7 at UniProt or InterPro

Protein Sequence (457 amino acids)

>PP_4366 flagellum-specific ATP synthase (Pseudomonas putida KT2440)
MPWTAQMRLERTSFGKRLGTYAEAIELPAQPIVEGRLLRMVGLTLEAEGLRAAVGSRCLV
INDDSYHPVQVEAEVMGFAGPKVFLMPVGSIVGIAPGARVVPLDDGGRLPMGMSMLGRVL
DGAGRALDGKGGMKAEDWVPMDGPVINPLNRDPISKPLDVGIRSINGLLTVGRGQRLGLF
AGTGVGKSVLLGMMTRFTEAEIIVVGLIGERGREVKEFIEHILGEEGLKRSVVVASPADD
APLMRLRAAMYCTRIAEYFRDKGKNVLLLMDSLTRFAQAQREIALAIGEPPATRGYPPSV
FAKLPKLVERAGNGEPGGGSITAFYTVLSEGDDQQDPIADSARGVLDGHFVLSRRLAEEG
HYPAIDIEASISRVMPQVVDADHLRQAQKFKQLWSRLSQSRDLISVGAYVAGGDPETDLA
IALQSKLVEFLRQGLRENVGMAQSREQLGAIFTPPAG