Protein Info for PP_4355 in Pseudomonas putida KT2440

Annotation: flagellar export apparatus subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 79 (34 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details PF00813: FliP" amino acids 52 to 244 (193 residues), 279.7 bits, see alignment E=7.1e-88 TIGR01103: flagellar biosynthetic protein FliP" amino acids 52 to 248 (197 residues), 294.6 bits, see alignment E=1.8e-92

Best Hits

Swiss-Prot: 80% identical to FLIP_PSEAE: Flagellar biosynthetic protein FliP (fliP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 99% identity to ppg:PputGB1_3917)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EU8 at UniProt or InterPro

Protein Sequence (251 amino acids)

>PP_4355 flagellar export apparatus subunit (Pseudomonas putida KT2440)
MSGALRTLLTLALLLAAPLALAADPLSIPAITLSNTPDGQQEYSVSLQILLIMTALSFIP
AFVILMTSFTRIIIVFSILRQALGLQQTPSNQLLTGMALFLTMFIMAPVFDRVNQDALQP
YLKEQMTAQQAIDKAQGPLKDFMLAQTRQSDLDLFMRLSKRTDIAGPDQVPLTILVPAFV
TSELKTAFQIGFMIFIPFLIIDMVVASVLMAMGMMMLSPLIISLPFKIMLFVLVDGWALI
MGTLASSFGGV