Protein Info for PP_4352 in Pseudomonas putida KT2440

Annotation: flagellin export apparatus, substrate specificity protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 37 to 61 (25 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details TIGR00328: flagellar biosynthetic protein FlhB" amino acids 8 to 355 (348 residues), 404.2 bits, see alignment E=2.5e-125 PF01312: Bac_export_2" amino acids 8 to 349 (342 residues), 429.3 bits, see alignment E=5.5e-133

Best Hits

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 100% identity to ppu:PP_4352)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EV1 at UniProt or InterPro

Protein Sequence (380 amino acids)

>PP_4352 flagellin export apparatus, substrate specificity protein (Pseudomonas putida KT2440)
MAESESGQDKTEDPTEKRKRDAREKGEVARSKELNTVAVTLAGAGGLLAFGGHVAETLLA
LMRMNFSLTRDIIVDERAMGAFLLASGKMAIWAVQPVLILLFVVSFVAPIALSGFLFSGS
LLQPKFSRMNPLSGIKRMFSMQALTELLKALAKFFVILVVAVVVLSGDRQALLSIANEPL
EQAIIHSLQVVGWSALWMSAGLLLIAAADVPFQLYQTHKKMKMTKQEVRDEYKDSEGKPE
VKQRIRQLQREVSQRRMMAAVPDADVIITNPTHYAVALQYDPEKGGAAPLLLAKGSDFMA
LKIREIGVEHNIQILESPALARAIYYSTELEQEIPAGLYLAVAQVLAYVFQIRQYRAGKG
KRPEPLKDDLPIPPDLRRDS