Protein Info for PP_4342 in Pseudomonas putida KT2440

Annotation: flagellar synthesis regulator, putative ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF06564: CBP_BcsQ" amino acids 8 to 152 (145 residues), 24.8 bits, see alignment E=5.2e-09 PF10609: ParA" amino acids 8 to 247 (240 residues), 82.2 bits, see alignment E=1.4e-26 PF13614: AAA_31" amino acids 8 to 165 (158 residues), 59.9 bits, see alignment E=1.2e-19 PF09140: MipZ" amino acids 9 to 133 (125 residues), 24.3 bits, see alignment E=6.5e-09 PF01656: CbiA" amino acids 10 to 225 (216 residues), 61.5 bits, see alignment E=2.9e-20 PF00142: Fer4_NifH" amino acids 11 to 257 (247 residues), 50.5 bits, see alignment E=7.4e-17 PF02374: ArsA_ATPase" amino acids 12 to 45 (34 residues), 26 bits, see alignment 1.8e-09

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 99% identity to pen:PSEEN3797)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EW0 at UniProt or InterPro

Protein Sequence (277 amino acids)

>PP_4342 flagellar synthesis regulator, putative ATPase (Pseudomonas putida KT2440)
MGSMHPVQVIAVTGGKGGVGKTNVSVNLSLALAELGRRVMLLDADLGLANVDVLLGLTPK
RTLADVIEGRCELRDVMLQGPGGVRIVPAASGTQSMVHLAPAQHAGLIQAFSEIGDNLDV
LVIDTAAGIGDSVVSFVRAAQEVLLVVCDEPTSITDAYALIKLLNRDYGMNRFRVLANMA
QSPQEGRNLFAKLTKVTDRFLDVALQYVGAVPYDECVRKAVQKQRAVYEAFPRSKCALAF
KAIAQKVDSWPLPANPRGHLEFFVERLVQPTSAGPVL