Protein Info for PP_4337 in Pseudomonas putida KT2440

Annotation: chemotaxis response regulator protein-glutamate methylesterase of group 1 operon

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF00072: Response_reg" amino acids 5 to 109 (105 residues), 76 bits, see alignment E=2.6e-25 PF01339: CheB_methylest" amino acids 189 to 365 (177 residues), 212.2 bits, see alignment E=4.5e-67

Best Hits

Swiss-Prot: 100% identical to CHEB1_PSEPK: Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon (cheB1) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 100% identity to ppf:Pput_1530)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EW5 at UniProt or InterPro

Protein Sequence (370 amino acids)

>PP_4337 chemotaxis response regulator protein-glutamate methylesterase of group 1 operon (Pseudomonas putida KT2440)
MAVKVLVVDDSGFFRRRVSEILSADPTIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVKQ
LLCEKVHTISRSNRRIGSYARTAPVAAPAPASTFTSQAQTRPAAPARAAAPTPAASQSPA
PKRKPYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFAERLDKLCRI
SVKEAEDGDMLRPGLALLAPGGKQMMIDGRGTVKILPGDERLNYKPCVDITFGSAAKSYG
DKVLSVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKANLADAVYSLDE
IGKHLVEACV