Protein Info for PP_4325 in Pseudomonas putida KT2440

Annotation: protoheme IX reservoir complex subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 60 to 87 (28 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 16 to 187 (172 residues), 122.6 bits, see alignment E=9.6e-40 TIGR01191: heme exporter protein CcmC" amino acids 48 to 231 (184 residues), 275.7 bits, see alignment E=9.5e-87

Best Hits

Swiss-Prot: 84% identical to CCMC_PSEAE: Heme exporter protein C (ccmC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02195, heme exporter protein C (inferred from 100% identity to ppf:Pput_1542)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EX7 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PP_4325 protoheme IX reservoir complex subunit (Pseudomonas putida KT2440)
MKISWTWFHKLGSPKWFYAISGRMLPWLAGAAVLLLLVGITWGLAFAPQDYQQGNSFRII
YIHVPAAMLAQSCYVLLAVAGVVGLVWKMKLADVALQCAAPIGAWMTAVALVTGAIWGKP
TWGSWWVWDARLTSMLILLFLYFGIIALGQAISNRDSAAKACAVLAIVGVVNIPIIKYSV
EWWNTLHQGATFTLTEKPAMPAEMWLPLLCTALGFYCFFGAVLLLRMRLEVLKREARASW
VRDEVLNSLGRRAAQ