Protein Info for PP_4308 in Pseudomonas putida KT2440

Annotation: Transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF13412: HTH_24" amino acids 3 to 49 (47 residues), 43.7 bits, see alignment E=3.3e-15 PF13404: HTH_AsnC-type" amino acids 3 to 43 (41 residues), 44.8 bits, see alignment E=1.8e-15 PF09339: HTH_IclR" amino acids 9 to 49 (41 residues), 24.8 bits, see alignment E=3e-09 PF01037: AsnC_trans_reg" amino acids 65 to 140 (76 residues), 49.7 bits, see alignment E=5.6e-17

Best Hits

Swiss-Prot: 30% identical to REG6_PYRAB: Uncharacterized HTH-type transcriptional regulator PYRAB06490 (PYRAB06490) from Pyrococcus abyssi (strain GE5 / Orsay)

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 100% identity to ppf:Pput_1559)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EZ2 at UniProt or InterPro

Protein Sequence (145 amino acids)

>PP_4308 Transcriptional regulator, AsnC family (Pseudomonas putida KT2440)
MTDAIDQLLINALMEDSRRSLKALAQVSGLSAPSVSERLRRLEERGVLRGYTVEVDPRAF
GYQLQAIVRIRPLPGKLQEVERQIIAIPEFTECDKVIGEDCFVARLHVRSMEQLDTLLDL
MNVLAETNTAIIKKTPVKRRLPPMD