Protein Info for PP_4302 in Pseudomonas putida KT2440

Annotation: Urea transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 31 to 62 (32 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 97 to 113 (17 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details PF03253: UT" amino acids 15 to 272 (258 residues), 148 bits, see alignment E=1.7e-47

Best Hits

KEGG orthology group: K08717, urea transporter (inferred from 96% identity to ppw:PputW619_3627)

Predicted SEED Role

"Eukaryotic-type low-affinity urea transporter" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88EZ8 at UniProt or InterPro

Protein Sequence (291 amino acids)

>PP_4302 Urea transporter (Pseudomonas putida KT2440)
MYTKNFVNPCPDWATALLNGFSQVLLLRNPLCGLCCLLAILLTAPNLVGGALLGALAGLL
TAQARGYDRADRQAGLYCYNGVLIGILISAVLPWSAILPPLIIAAGGLSSIITHQWRKRG
GKLLIAYTSPFVLLGWATLLVASPSPSGFVEADPLYALARGVGQIFLLDQPLAGLLIIVG
MFIVNPYAAMWAVIGSAIGGGVALLTDQAQAAWLGLYGFNGALAALAFSRQGEKPWVTVL
AIALALLLQPLLNLMPIAGLTAPFVLACWLMHSGNHFWQLLLRRNIWRLHN