Protein Info for PP_4272 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 54 to 70 (17 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details PF11158: DUF2938" amino acids 35 to 180 (146 residues), 222.3 bits, see alignment E=1.1e-70

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4272)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F27 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PP_4272 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MKLTSTSMLRGMVMTVNLRGLVQMTFTAMFLAALPIGIGATVVMDLWGLLLRRLGIATLN
FAMVGRWAGHLLGGRVSHQAIAKAEPVQNELAWGWVIHYATGVLFAMLLVVIVGEGWLRS
PTLLPAVVVGVGTAVAPLCFMQPAMGAGFFSSRTPTPARNCLKSLATHFVFGVGLFLSAG
LLALV