Protein Info for PP_4268 in Pseudomonas putida KT2440

Annotation: nucleoid-associated broad specificity regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 3 to 107 (105 residues), 112.1 bits, see alignment E=6.4e-37 PF02575: YbaB_DNA_bd" amino acids 10 to 101 (92 residues), 118.8 bits, see alignment E=4.8e-39

Best Hits

Swiss-Prot: 100% identical to Y4268_PSEPK: Nucleoid-associated protein PP_4268 (PP_4268) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K09747, hypothetical protein (inferred from 96% identity to pen:PSEEN1789)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F31 at UniProt or InterPro

Protein Sequence (111 amino acids)

>PP_4268 nucleoid-associated broad specificity regulator (Pseudomonas putida KT2440)
MMKGGMAGLMKQAQQMQEKMQKMQEELANAEVTGQSGGGLVSVVMTGRHDVKRVSIDQSL
MSTDEDDKEVLEDLIAAALNDAVRKVEQSSQEKMGGMTAGMQLPPGFKMPF