Protein Info for PP_4264 in Pseudomonas putida KT2440

Annotation: oxygen-independent coproporphyrinogen III dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 435 to 448 (14 residues), see Phobius details TIGR00538: oxygen-independent coproporphyrinogen III oxidase" amino acids 6 to 460 (455 residues), 585.3 bits, see alignment E=4.2e-180 PF04055: Radical_SAM" amino acids 57 to 232 (176 residues), 80.4 bits, see alignment E=1.8e-26 PF06969: HemN_C" amino acids 369 to 436 (68 residues), 43.5 bits, see alignment E=2.8e-15

Best Hits

Swiss-Prot: 76% identical to HEMN_PSEAE: Oxygen-independent coproporphyrinogen III oxidase (hemN) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 100% identity to ppf:Pput_1604)

Predicted SEED Role

"Coproporphyrinogen III oxidase, oxygen-independent (EC 1.3.99.22)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.99.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.22

Use Curated BLAST to search for 1.3.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F35 at UniProt or InterPro

Protein Sequence (460 amino acids)

>PP_4264 oxygen-independent coproporphyrinogen III dehydrogenase (Pseudomonas putida KT2440)
MLDDLRWDTDLIRRYDLAGPRYTSYPTAVQLHSEVGSFDLLNALRESRRAVRPLSLYVHV
PFCANICYYCACNKVITKDRARAAPYLQRLEQEIQLVACHLDPKQRVEQLHFGGGTPTFL
SHVELRQLMATLRQHFHLLDDDSGDYGIEIDPREADWSTMGLLRELGFNRVSLGVQDLDP
AVQRAINRLQSLEQTRTLIEAARTLQFRSVNLDLIYGLPKQTPEGFARTVEEVIRLQPDR
LSVFNYAHLPERFMPQRRIDSNDLPSAAAKLEMLHATIDQLTAAGYRYIGMDHFALPDDE
LAIAQEEGTLQRNFQGYTTHGHCDLIGLGVSAISQIGDLYCQNSSDLNTYQDSLSNAQLA
TQRGLLCNHDDRIRRAVIQQLICHFELDFEPIEQAFTLDFRGYFNDLWPELLTLQRDGLI
SLDDKGIRILPAGRLLARSVCMVFDAYLAMHNRQRFSRVI