Protein Info for PP_4261 in Pseudomonas putida KT2440

Annotation: cation-transporting P-type ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 824 transmembrane" amino acids 181 to 200 (20 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 429 to 448 (20 residues), see Phobius details amino acids 454 to 478 (25 residues), see Phobius details amino acids 753 to 770 (18 residues), see Phobius details amino acids 776 to 794 (19 residues), see Phobius details PF12156: ATPase-cat_bd" amino acids 7 to 89 (83 residues), 101.7 bits, see alignment E=8.9e-33 PF00403: HMA" amino acids 96 to 156 (61 residues), 38.8 bits, see alignment 3.1e-13 TIGR01511: copper-translocating P-type ATPase" amino acids 231 to 796 (566 residues), 474.5 bits, see alignment E=1.1e-145 TIGR01525: heavy metal translocating P-type ATPase" amino acids 248 to 796 (549 residues), 519.1 bits, see alignment E=3.6e-159 TIGR01512: cadmium-translocating P-type ATPase" amino acids 281 to 797 (517 residues), 375.2 bits, see alignment E=1e-115 TIGR01494: HAD ATPase, P-type, family IC" amino acids 286 to 776 (491 residues), 227.4 bits, see alignment E=5.1e-71 PF00122: E1-E2_ATPase" amino acids 311 to 411 (101 residues), 85.8 bits, see alignment E=4.6e-28 PF00702: Hydrolase" amino acids 504 to 708 (205 residues), 97.8 bits, see alignment E=3.3e-31 PF12710: HAD" amino acids 627 to 704 (78 residues), 32.3 bits, see alignment E=4e-11 PF08282: Hydrolase_3" amino acids 681 to 738 (58 residues), 36.2 bits, see alignment 1.7e-12

Best Hits

KEGG orthology group: K01533, Cu2+-exporting ATPase [EC: 3.6.3.4] (inferred from 100% identity to ppu:PP_4261)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoI; Copper-translocating P-type ATPase (EC 3.6.3.4)" (EC 3.6.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.4

Use Curated BLAST to search for 3.6.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F38 at UniProt or InterPro

Protein Sequence (824 amino acids)

>PP_4261 cation-transporting P-type ATPase (Pseudomonas putida KT2440)
MTQPTPCYHCALPVPTGSRFTAVVLGQPRQFCCPGCQAVAESIVAGGLEHYYQHRSDNSA
NPEALPKQLQDELALYDRSDVQQTFVRHQGELAETTLLVEGISCAACGWLIEKHLRNLPG
VAEARLNLSNHRLLLNWDDKQLPLSRLLAELRQIGYAAHPYQPDQAAEQLARENRSALRR
LGVAGLLWFQAMMATMATWPEFNIDLTPELHAILRWVALFLTIPIVFYSCAPFFKGAARD
LRTRHLTMDVSVSLAIGLAFGAGIWTAITGSGELYFDTVGMFALFLLTGRYLERRARERT
AAATAQLVNLLPASCLRLDAIGRSERILLSELQCGDTVQVLPGAVIPADGRIVEGRSSVD
ESLLTGEYLPQPRRVGERVTGGTLNVESALNVEVEALGHDSRLSAIVRLLERAQTEKPRL
AEIADRASQWFLLFSLLAAVAIGLWWWHLDPTRAFWIVLAMLVATCPCALSLATPTALTA
ATGTLHKLGLLVTRGHVLEGLNQIDTVIFDKTGTLTEGRLTLRSIRPLGSQAADRCLALA
AALENRSEHPIARAFGRTATPADDVQSVPGLGLEGVVDGQRLRIGQATFVCALSGAEIPA
VPEPRGQWLLLGDRQGPLAWFGLDDRLRDDAPALLAACKARGWHTLLLSGDSSPMVAEVA
AQLGIDQAIGGLRPDDKLDRLKALQADGRKVLMLGDGVNDVPVLAAADISIAMGSATDLA
KTSADAVLLSNRLQALVQAFELARRTRRNILENLLWATLYNGLMLPFAALGWITPVWAAI
GMSVSSLIVVLNALRLTRMPVASGPLPHEAPLPGRKSPCPPSMS