Protein Info for PP_4253 in Pseudomonas putida KT2440

Annotation: cytochrome c oxidase subunit, cbb3-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details TIGR00782: cytochrome c oxidase, cbb3-type, subunit III" amino acids 36 to 303 (268 residues), 264.9 bits, see alignment E=4.1e-83 PF14715: FixP_N" amino acids 37 to 83 (47 residues), 83.8 bits, see alignment 8.1e-28 PF13442: Cytochrome_CBB3" amino acids 132 to 205 (74 residues), 51.2 bits, see alignment E=1.9e-17 amino acids 220 to 298 (79 residues), 44.1 bits, see alignment E=3.2e-15 PF00034: Cytochrom_C" amino acids 134 to 207 (74 residues), 33.5 bits, see alignment E=1.2e-11 amino acids 222 to 257 (36 residues), 33.8 bits, see alignment 1e-11

Best Hits

Swiss-Prot: 72% identical to CCOP2_PSEST: Cbb3-type cytochrome c oxidase subunit CcoP2 (ccoP2) from Pseudomonas stutzeri

KEGG orthology group: K00406, cb-type cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to ppu:PP_4253)

MetaCyc: 100% identical to cbb3-1 cytochrome c oxidase subunit P (Pseudomonas putida KT2440)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F46 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PP_4253 cytochrome c oxidase subunit, cbb3-type (Pseudomonas putida KT2440)
MTTFWSTYISVLTIGSLIGLTWLLLATRKGQSNNTTDETMGHSFDGIEEYDNPLPKWWFW
LFVGTLAFSVGYLILYPGLGNWKGILPGYENGWTGANEWQKEMDKADARFGPIFAKYAAM
PVEEVAKDPQALKMGSRLFASNCSVCHGSDAKGAFGFPNLTDNDWRWGGDPETIKTSIMS
GRHGVMPAWAEVIGDQGVADVAAFVVSKLDGRTLPEGAKADVENGQKIFAANCVACHGPE
GKGTPAMGAPNLTHPQAFIYGSSFAQLQQTIRYGRQGQMPAQAEIQGNDKVHLLAAYVYS
LSQDGSAEAVTAK