Protein Info for PP_4245 in Pseudomonas putida KT2440

Annotation: hydroxyproline acetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF13523: Acetyltransf_8" amino acids 171 to 315 (145 residues), 195.9 bits, see alignment E=1.3e-62

Best Hits

KEGG orthology group: None (inferred from 96% identity to ppg:PputGB1_3811)

MetaCyc: 74% identical to N-hydroxyornithine acetyltransferase (Pseudomonas aeruginosa Pa4)
2.3.1.-

Predicted SEED Role

"Hypothetical protein PvdY" in subsystem Siderophore Pyoverdine

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F54 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PP_4245 hydroxyproline acetylase (Pseudomonas putida KT2440)
MPFDAASQPQSPPRWRSLSAEEGDSWLSLALEGRPLIQLRLEAGASLHVHLERFCPERPY
QALWAACYWLLSRDTACQRLTWHLPEVLPQALASGLLLAGEQPGQYLCERALFWQLPQPW
LGESVAGVYPQQMQISNGKRHPRRAPKPRGEVYRRFDARLGSWVSLRTLEIEHDLERFNR
WQNNPRVEAFWQEGGTLAQHREYLAKLEADPHTLTLIGCFDDEPFAYFEAYWAKEDRIAP
FYPADDYDRGIHMLVGEESHRGPHKVASWLSALVHYLFLDDPRTQRVVAEPRADNGKMIG
YMHDQCFHCDKEFDFPHKRAALMILGRERFFDRCKLT