Protein Info for PP_4231 in Pseudomonas putida KT2440

Annotation: putative Xanthine dehydrogenase accessory factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF02625: XdhC_CoxI" amino acids 18 to 67 (50 residues), 57.7 bits, see alignment 8.9e-20 PF13478: XdhC_C" amino acids 169 to 311 (143 residues), 112.4 bits, see alignment E=2.2e-36

Best Hits

KEGG orthology group: K07402, xanthine dehydrogenase accessory factor (inferred from 99% identity to ppf:Pput_1633)

Predicted SEED Role

"Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F67 at UniProt or InterPro

Protein Sequence (323 amino acids)

>PP_4231 putative Xanthine dehydrogenase accessory factor (Pseudomonas putida KT2440)
MQHLDLQVIRQALQWSCNGERVWLCTVLATYGSAPRAPGSLLAVNASGQWLGSLSGGCVE
DDFLERVALGEFPEPVAIVRYGDGSDPRSRVRLPCGGVLEVLVENLPVECEVQAHLRELE
RALLGQRRVLREVSLPTGTRQLLDDHSQGPRVERENARVRLRVGAAQRLLLAGYSSVAHF
CAEFGRGLGFEVILCEPRDEVLDGVVLNGIEVRRELPSEFIANGGCHADTAVVALTHDPK
IDDLAMLEAVRTEAFYIGVMGSKATSDKRRERLQRIGGLGCDELARIHAPIGLNLGSKTP
AEIALAVLADILRARNGIERAAL