Protein Info for PP_4209 in Pseudomonas putida KT2440

Annotation: ABC export system, membrane fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 37 to 384 (348 residues), 169.9 bits, see alignment E=3.5e-54 PF25917: BSH_RND" amino acids 61 to 216 (156 residues), 68 bits, see alignment E=1.6e-22 PF25973: BSH_CzcB" amino acids 62 to 211 (150 residues), 35.8 bits, see alignment E=1.8e-12 PF25876: HH_MFP_RND" amino acids 110 to 175 (66 residues), 29.9 bits, see alignment E=1.7e-10 PF25967: RND-MFP_C" amino acids 326 to 385 (60 residues), 35 bits, see alignment E=3.4e-12

Best Hits

KEGG orthology group: K13888, macrolide-specific efflux protein MacA (inferred from 100% identity to ppu:PP_4209)

Predicted SEED Role

"pyoverdine-specific efflux macA-like protein" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88F89 at UniProt or InterPro

Protein Sequence (392 amino acids)

>PP_4209 ABC export system, membrane fusion protein (Pseudomonas putida KT2440)
MRRSTHTRRRLLLGGLGLLGLGSLLAWTSLPFGAQPVSTVAVTRADIESSVTALGTLQPR
RYVDVGAQASGQIRNLHVEVGDQVHKGQLLVEIDPSTQQAKLDAGRFSIDNLKAQLAEQR
AQLKLAQQQLKRQRDLAAVGATREEDLQTAEAQLNVTQARIDMYQAQIRQANASLRSDEA
ELGYTRIFAPMDGTVVAVDAREGQTLNAQQQTPLILRIAKLSPMTVWAQVSEADIGKIQP
GMTAYFTTLAGGKRRWTSTVRQVLPIPPKPLDQTSQGGGSPASATAGATGSQVVQYTVLL
DVDNPDGALMAEMTTQVFFVVGQASQVLSAPLAALDDSDNEGLRLAQVFGRDGKVEQRKV
RTGLSDRLRVQILDGLSEGDRLVIGAPAASGG