Protein Info for PP_4187 in Pseudomonas putida KT2440

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 4 to 472 (469 residues), 543.7 bits, see alignment E=1.7e-167 PF07992: Pyr_redox_2" amino acids 5 to 334 (330 residues), 254.3 bits, see alignment E=8.3e-79 PF12831: FAD_oxidored" amino acids 6 to 38 (33 residues), 28.5 bits, see alignment (E = 4.9e-10) PF00890: FAD_binding_2" amino acids 6 to 47 (42 residues), 31.9 bits, see alignment 4.3e-11 PF01134: GIDA" amino acids 6 to 61 (56 residues), 24.7 bits, see alignment 6e-09 PF13738: Pyr_redox_3" amino acids 138 to 318 (181 residues), 32.6 bits, see alignment E=2.7e-11 PF00070: Pyr_redox" amino acids 183 to 259 (77 residues), 66.3 bits, see alignment E=1.4e-21 PF02852: Pyr_redox_dim" amino acids 353 to 462 (110 residues), 141.5 bits, see alignment E=6e-45

Best Hits

Swiss-Prot: 100% identical to DLDH2_PSEPU: Dihydrolipoyl dehydrogenase (lpdG) from Pseudomonas putida

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 99% identity to pen:PSEEN3638)

MetaCyc: 48% identical to dihydrolipoyl dehydrogenase subunit (Syntrophotalea carbinolica DSM 2380)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FB1 at UniProt or InterPro

Protein Sequence (478 amino acids)

>PP_4187 dihydrolipoyl dehydrogenase (Pseudomonas putida KT2440)
MTQKFDVVVIGAGPGGYVAAIKAAQLGLKTACIEKYTDAEGKLALGGTCLNVGCIPSKAL
LDSSWKYKEAKESFNVHGISTGEVKMDVAAMVGRKAGIVKNLTGGVATLFKANGVTSIQG
HGKLLAGKKVEVTKADGTTEVIEAENVILASGSRPIDIPPAPVDQNVIVDSTGALEFQAV
PKRLGVIGAGVIGLELGSVWARLGAEVTVLEALDTFLMAADTAVSKEAQKTLTKQGLDIK
LGARVTGSKVNGNEVEVTYTNAEGEQKITFDKLIVAVGRRPVTTDLLASDSGVTIDERGY
IFVDDYCATSVPGVYAIGDVVRGMMLAHKASEEGIMVVERIKGHKAQMNYDLIPSVIYTH
PEIAWVGKTEQALKAEGVEVNVGTFPFAASGRAMAANDTGGFVKVIADAKTDRVLGVHVI
GPSAAELVQQGAIAMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGGAIHVANRKKR