Protein Info for PP_4155 in Pseudomonas putida KT2440

Annotation: putative amine oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF01593: Amino_oxidase" amino acids 4 to 73 (70 residues), 36.4 bits, see alignment E=1.2e-12 amino acids 90 to 195 (106 residues), 67.2 bits, see alignment E=5.5e-22 amino acids 238 to 401 (164 residues), 82.3 bits, see alignment E=1.4e-26 PF01494: FAD_binding_3" amino acids 81 to 114 (34 residues), 26.5 bits, see alignment 1.1e-09 PF01266: DAO" amino acids 81 to 273 (193 residues), 33.2 bits, see alignment E=1.3e-11 PF00890: FAD_binding_2" amino acids 82 to 119 (38 residues), 30 bits, see alignment 9.8e-11 PF13450: NAD_binding_8" amino acids 84 to 142 (59 residues), 54.3 bits, see alignment E=4e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4155)

Predicted SEED Role

"Monoamine oxidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FE2 at UniProt or InterPro

Protein Sequence (407 amino acids)

>PP_4155 putative amine oxidase (Pseudomonas putida KT2440)
MHRPTAWHVTHWSSDPFSLGAYSALLPGGSPLHRSALGQVLHGRLVIAGEACNASAPAMT
HGAWNDGLRAAEAAVSAGASKVIVIGAGCAGLAAAQRLRERGVDCTVLEARGRTGGRTHT
VELGGVKADEGAAWLQHFAENPLAAVALQHGLACVETDFSCPLAAARGGALPDIDAAWDA
LTRRLDRQQPLSDAIDGYMATLDPALARATQFAIDANLVLEACLPVEQLSACALDEEGVG
HGDRMLPGGYSELVDLLSKHLDIRLNSPVTHIDWSSARVMVNEDVCDFCICTVPVGVLKT
LRFTPALPEIQQGALAHLGMGKLEKVILQFDERWWPCSPSGYLRWYDVPASWGEWLDLTD
AVGKPTIAGLIAADAIERQFTGRTDEQVAMAACEALQAWAAAVGPTP