Protein Info for PP_4138 in Pseudomonas putida KT2440

Annotation: Chromate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03358: FMN_red
  • amino acids 7 to 149 (143 residues), 135.3 bits, E=1.4e-43
• PF02525: Flavodoxin_2
  • amino acids 7 to 120 (114 residues), 32.5 bits, E=7.1e-12

Best Hits

Swiss-Prot: 100% identical to CHRR_PSEPK: Quinone reductase (chrR) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_1727)

MetaCyc: 100% identical to quinone reductase (Pseudomonas putida KT2440)
RXN0-5330 [EC: 1.6.5.9]

Predicted SEED Role

"FMN reductase, NADPH-dependent"

MetaCyc Pathways

• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (7/8 steps found)
• NADH to cytochrome bo oxidase electron transfer II (2/2 steps found)
• mitochondrial NADPH production (yeast) (4/5 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• NADH to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• NADH to cytochrome bd oxidase electron transfer II (1/2 steps found)
• NADH to nitrate electron transfer (1/2 steps found)
• nitrate reduction VIIIb (dissimilatory) (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.9

Sequence Analysis Tools

See Q88FF8 at UniProt or InterPro

Protein Sequence (186 amino acids)

>PP_4138 Chromate reductase (Pseudomonas putida KT2440)
MSQVYSVAVVVGSLRKESYNRKVARALSELAPSSLALKIVEIGDLPLYNEDIEAEAPPET
WKRFRDEIRRSDAVLFVTPEYNRSVPGCLKNAIDVGSRPYGQSAWSGKPTAVVSVSPGAI
GGFGANHAVRQSLVFLDMPCMQMPEAYLGGAASLFEDSGKLNDKTRPFLQAFVDRFASWV
KLNRAV