Protein Info for PP_4120 in Pseudomonas putida KT2440

Annotation: NADH-quinone oxidoreductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 40 to 183 (144 residues), 223.3 bits, E=5.3e-71
• PF01058: Oxidored_q6
  • amino acids 68 to 176 (109 residues), 91.5 bits, E=1.9e-30

Best Hits

Swiss-Prot: 100% identical to NUOB_PSEP1: NADH-quinone oxidoreductase subunit B (nuoB) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 99% identity to ppw:PputW619_1872)

MetaCyc: 100% identical to NADH-quinone oxidoreductase subunit B (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (3/6 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

See Q88FH6 at UniProt or InterPro

Protein Sequence (225 amino acids)

>PP_4120 NADH-quinone oxidoreductase subunit B (Pseudomonas putida KT2440)
MQYNLTRIDPDAPNEQYPVGERETVTDQLLEDQVHKNIFMGKLEDVLRGAVNWGRKNSLW
PYNFGLSCCYVEMTTAFTAPHDIARFGAEVIRASPRQADFMVIAGTCFVKMAPIIQRLYE
QMLEPKWVISMGSCANSGGMYDIYSVVQGVDKFLPVDVYVPGCPPRPEAFLQGLMLLQES
IGQERRPLSWVVGDQGIYRAEMPAQKDLRREQRIAVTNLRSPDEV