Protein Info for PP_4112 in Pseudomonas putida KT2440

Annotation: Sulphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 42 to 59 (18 residues), see Phobius details amino acids 65 to 81 (17 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 356 to 384 (29 residues), see Phobius details PF00916: Sulfate_transp" amino acids 12 to 360 (349 residues), 173.6 bits, see alignment E=8.6e-55 PF01740: STAS" amino acids 405 to 483 (79 residues), 41.4 bits, see alignment E=1.7e-14 PF13466: STAS_2" amino acids 408 to 483 (76 residues), 30.3 bits, see alignment E=6.1e-11

Best Hits

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_1752)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FWK8 at UniProt or InterPro

Protein Sequence (486 amino acids)

>PP_4112 Sulphate transporter (Pseudomonas putida KT2440)
MHHRKPMKPARLRADLLAGLTTSFALVPECIAFALVAHLNPLMGLYGAFIICTLTALFGG
RPGMISGAAGSMAVVIVALVVQHGVQYLLATVLLGGVVMILFGLLRLGKLVRLVPYPVML
GFVNGLAIVIAMAQLEHFKDGEHWLSGTPLYLMIGLVALTMAVVYVLPKLTRAVPPALVA
ILGVGLVVYVLGLPTRTLGDMAHIAGGLPGLALPDVPWNLETLKIIAPYAVLMAMVGLLE
TLLTLNLTDEITESRGFPDRECVALGAANMVSGLCGGMGGCAMIGQTVINLSSNGRGRLS
GVVAGVMILLFVLFLSPLIERIPLAALVGVMFVVAQQTFAWASLRVLHKVPVNDVLAIVA
VTVVTVLTDLAMAVLFGIIIAALNFAWQHARELYADTHEDAEGGKCYQLHGTLFFASTTS
FLNQFDTAGDPAQVTLDCQHLSFVDYSAVAALKTLRERYAKAGKHLRVVHLSERCKKLLK
RAGEQH