Protein Info for PP_4111 in Pseudomonas putida KT2440

Annotation: Elongation factor G 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 TIGR00484: translation elongation factor G" amino acids 1 to 700 (700 residues), 1166.2 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 10 to 288 (279 residues), 208.4 bits, see alignment E=2.2e-65 TIGR00231: small GTP-binding protein domain" amino acids 11 to 188 (178 residues), 116.9 bits, see alignment E=7.5e-38 PF22042: EF-G_D2" amino acids 317 to 400 (84 residues), 60.7 bits, see alignment E=3.5e-20 PF03144: GTP_EFTU_D2" amino acids 332 to 399 (68 residues), 61.2 bits, see alignment E=3.2e-20 PF14492: EFG_III" amino acids 412 to 486 (75 residues), 119.4 bits, see alignment E=1.7e-38 PF03764: EFG_IV" amino acids 487 to 605 (119 residues), 143.1 bits, see alignment E=1.1e-45 PF00679: EFG_C" amino acids 609 to 694 (86 residues), 97.7 bits, see alignment E=9.6e-32

Best Hits

Swiss-Prot: 100% identical to EFG2_PSEPK: Elongation factor G 2 (fusB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to ppu:PP_4111)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FI4 at UniProt or InterPro

Protein Sequence (703 amino acids)

>PP_4111 Elongation factor G 2 (Pseudomonas putida KT2440)
MARTTPIELYRNIGIVAHVDAGKTTTTERILFYTGVNHKMGEVHDGAATMDWMAQEQERG
ITITSAATTAFWQGSTKQFAHKYRFNIIDTPGHVDFTIEVERSLRVLDGAVVVFSGADGV
EPQSETVWRQANKYHVPRLAYINKMDRQGADFLRVVKQIDQRLGHHPVPIQLAIGSEENF
MGQIDLVKMKAIYWNDADQGTSYREEEIPAELKALADEWRAHMIEAAAEANDELTMKFLD
GEELSIEEIKAGLRQRTIANEIVPTILGSSFKNKGVPLMLDAVIDYLPAPSEIPAIRGTD
PDDEEKHLERHADDKEPFSALAFKIATDPFVGTLTFARVYSGVLSSGNAVLNSVKGKKER
IGRMVQMHANQRAEIKDVCAGDIAALIGMKDVTTGDTLCDMDKPIILERMDFPDPVISVA
VEPKTKADQEKMGIALGKLAQEDPSFRVRTDEETGQTIISGMGELHLDIIVDRMRREFNV
EANIGKPQVAYREKIRNTCEIEGRFVRQSGGRGQYGHCWIRFAPGDEGKEGLEFINEIVG
GVVPREYIPAIQKGIEEQMKNGVLAGYPLINLKAAVFDGSYHDVDSNEMAYKIAASMATK
QLSQKGGAVLLEPVMKVEVVTPEEYQGDILGDLSRRRGMIQDGDETPAGKVIRAEVPLGE
MFGYATSMRSMTQGRASFSMEFTRYAEAPASIADGIVKKSRGE