Protein Info for PP_4066 in Pseudomonas putida KT2440

Annotation: methylglutaconyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF00378: ECH_1" amino acids 15 to 262 (248 residues), 160.3 bits, see alignment E=5.7e-51 PF16113: ECH_2" amino acids 18 to 193 (176 residues), 92.2 bits, see alignment E=4.8e-30

Best Hits

KEGG orthology group: K13766, methylglutaconyl-CoA hydratase [EC: 4.2.1.18] (inferred from 99% identity to ppf:Pput_1775)

MetaCyc: 100% identical to 3-methylglutaconyl-CoA hydratase (Pseudomonas putida)
Methylglutaconyl-CoA hydratase. [EC: 4.2.1.18]

Predicted SEED Role

"Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" in subsystem Benzoate transport and degradation cluster or HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism (EC 4.2.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FM3 at UniProt or InterPro

Protein Sequence (271 amino acids)

>PP_4066 methylglutaconyl-CoA hydratase (Pseudomonas putida KT2440)
MSDFSTLEVIRDPRGFATLWLSREDKNNAFNAQMIRELIVAIDQLAEDASLRFVLLRGRG
RHFSAGADLAWMQQSAQLDFNTNLDDAHELGELMYALHRLKAPTLAVVQGAAFGGALGLI
SCCDMAIGAEDAQLCLSEVRIGLAPAVISPFVVKAIGERAARRYALTAERFTGVRARELG
LLAEVYPASELDDHVEAWVSNLLQNSPQALRATKDLLREVDDGELSPALRRYCENTIARI
RVSAEGQEGLRAFLEKRRPAWQTVDKKEPRP