Protein Info for PP_4063 in Pseudomonas putida KT2440

Annotation: putative Long-chain-fatty-acid-CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 PF00501: AMP-binding" amino acids 24 to 414 (391 residues), 306.8 bits, see alignment E=1.9e-95 PF13193: AMP-binding_C" amino acids 465 to 540 (76 residues), 64.5 bits, see alignment E=1.4e-21

Best Hits

Swiss-Prot: 46% identical to ACSF2_MACFA: Acyl-CoA synthetase family member 2, mitochondrial (ACSF2) from Macaca fascicularis

KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 100% identity to ppu:PP_4063)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FM6 at UniProt or InterPro

Protein Sequence (560 amino acids)

>PP_4063 putative Long-chain-fatty-acid-CoA ligase (Pseudomonas putida KT2440)
MSQPSYTRGRQDRPLLTQTIGQAFDATVARCCDSEALVSRHQGLRYSWRQLAEQVEIYAR
ALIALGVNTGDRVGIWSPNCAQWCILQLASAKVGAILVNINPAYRVGELEYVLRQSGCRW
LVCAEAFKTSDYHTMVQELVPELASAAPGELASECLPELRGVISLAANPPAGFLPWHAFA
ERAGQTSVEACTARQQSLQFDQPVNIQYTSGTTGAPKGATLSHYNILNNGFMVGESLGLT
ARDRMVIPVPLYHCFGMVMANLGCITHGSTMIYPNDAFDAELTLRAVAEERATILYGVPT
MFIAMLDHPSRAHMDLSTLRSGIMAGATCPIEVMRRVIDQMHMAEVQIAYGMTETSPVSL
QTGPDDDLELRVTTVGRTQPQLENKLVDADGCIVPRGEIGELCTRGYSVMLGYWDNPQAT
ADAIDPAGWMHSGDLAVMDEQGYVRIVGRNKDMIIRGGENIYPRELEEFFYTHPAVADAQ
VIGIPCSRYGEEIVAWIKLHPGHSATVEELQGWCKARIAHFKVPRYIRFVDEYPMTVTGK
VQKFRMREISVAEIAAASAG