Protein Info for PP_4050 in Pseudomonas putida KT2440

Annotation: glycogen synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 TIGR02095: glycogen/starch synthase, ADP-glucose type" amino acids 44 to 509 (466 residues), 489 bits, see alignment E=7.2e-151 PF08323: Glyco_transf_5" amino acids 44 to 278 (235 residues), 243.6 bits, see alignment E=4.9e-76 PF00534: Glycos_transf_1" amino acids 333 to 471 (139 residues), 59.9 bits, see alignment E=4.8e-20 PF13692: Glyco_trans_1_4" amino acids 336 to 471 (136 residues), 51 bits, see alignment E=4e-17

Best Hits

Swiss-Prot: 100% identical to GLGA_PSEPK: Glycogen synthase (glgA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00703, starch synthase [EC: 2.4.1.21] (inferred from 100% identity to ppu:PP_4050)

Predicted SEED Role

"Glycogen synthase, ADP-glucose transglucosylase (EC 2.4.1.21)" in subsystem Glycogen metabolism (EC 2.4.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FN9 at UniProt or InterPro

Protein Sequence (519 amino acids)

>PP_4050 glycogen synthase (Pseudomonas putida KT2440)
MISAAVEPHVDAFKPDNREPLTPDFATTGKAPGAQRQHNPNKRKILFVTSEIADLVKTGG
LGDVSAALPRALAHLHDVRVLIPGYRQVMESDNPIHIVGELGGHAALPPCKIGRMDMADG
LVIYVLICPELYQRDGTPYGANNGRDWPDNHIRFARLGLAAAEIAAGEGKIHWTPEVVHA
HDWPAGLAPAYMHWRGLNTPTLFTIHNLAYQGVYSRGCSPELAIPEHAMQQEGMEFYGKL
SFLKAGLAYSSHITTVSATYAREITTPEFGCGLDGFLASKAQQGLLGGIPNGIDESWDSA
TDKHLQHNFSINDWEGKARNTQEVRELFGLDDSEGPLFAVVSRLVYQKGLDLTLGVADYI
VEQGGQIAIIGRGEPEEEQAMRELALRHPGRIGVRIGFNETDARRMFAGSDFLLMPSRYE
PCGLSQMYAQRFGSLPVARNTGGLADTIECGVTGFLFNESTVESYREALSRAFYVYGKKD
LLNAMRCLSMTQPFNWCQAVEPYARLYEDLVKQTQLSHY