Protein Info for PP_4042 in Pseudomonas putida KT2440

Annotation: glucose-6-phosphate 1-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00871: glucose-6-phosphate dehydrogenase" amino acids 11 to 499 (489 residues), 563 bits, see alignment E=2.7e-173 PF00479: G6PD_N" amino acids 16 to 199 (184 residues), 190.9 bits, see alignment E=3.3e-60 PF02781: G6PD_C" amino acids 202 to 498 (297 residues), 384.1 bits, see alignment E=4e-119

Best Hits

Swiss-Prot: 47% identical to G6PD_NOSS1: Glucose-6-phosphate 1-dehydrogenase (zwf) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 100% identity to ppu:PP_4042)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.49

Use Curated BLAST to search for 1.1.1.49

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FP7 at UniProt or InterPro

Protein Sequence (501 amino acids)

>PP_4042 glucose-6-phosphate 1-dehydrogenase (Pseudomonas putida KT2440)
MTKQTLAAAPPCTLFLFGANGDLVKRLLMPALYNLSRDGLLDRNLRIVGVDHNPASAEDF
AARLHAFMVERDKGGEGSAKCLDEKLWARLAKRLDYQTGDFLDPATYQALARRIDKTRHG
NAIFYLATSPRFFPEVAQRLGQAGLLDESAGGFRRVVVEKPFGTDLASAEALNACLLKVM
GERQIYRIDHYLGKETVQNILVSRFSNGLFESFWNNHYIDHVQITAAETVGVETRGAFYD
STGALRDMVPNHLFQLLAMVAMEPPAAFGADAVRGEKAKVVGAIRPWSAKMAQKNSVRGQ
YRAGKQGRKPLPGYRQEPNVAPDSQTETYVALKVMIDNWRWAGVPFYLRTGKRMSVRDTE
IAICFKPAPYAQFRESELERPKPNYLKIQIQPNEGMWFDLQAKRPGPELVMENVELGFAY
KDFFKMTPATGYETLIYDCLTGDQTLFQRADNIENGWRAVQPFLDAWAQGGEVHEYSAGE
DGPEAGNELLTRDKREWHRLG