Protein Info for PP_4039 in Pseudomonas putida KT2440

Annotation: transcriptional regulator, TetR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF00440: TetR_N" amino acids 1 to 29 (29 residues), 26.4 bits, see alignment 4.9e-10 PF08362: TetR_C_3" amino acids 30 to 171 (142 residues), 174.8 bits, see alignment E=1.1e-55

Best Hits

KEGG orthology group: K09017, TetR/AcrR family transcriptional regulator (inferred from 100% identity to ppf:Pput_1799)

Predicted SEED Role

"Transcriptional regulator RutR of pyrimidine catabolism (TetR family)" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A140FWK3 at UniProt or InterPro

Protein Sequence (173 amino acids)

>PP_4039 transcriptional regulator, TetR family (Pseudomonas putida KT2440)
MGDIAEQAELPRSNLHYYFSTKDELFRAVLQDLLDVWKQDALCFENFDDPRVVLTSYIRA
KMGHSRSRPLGSKIWAEEMLHGAPVLGVNLDESLVPWAKMKEAKIRCWVEEGRILPVEPS
ALLYMIWASTQHYADFGYQVQLLNGGEVLSDMAFENAVQTVTSVILRGIGLEP