Protein Info for PP_4018 in Pseudomonas putida KT2440

Annotation: Acetyltransferase, GNAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 PF00583: Acetyltransf_1" amino acids 20 to 119 (100 residues), 46.1 bits, see alignment E=8.2e-16 PF13673: Acetyltransf_10" amino acids 24 to 137 (114 residues), 77 bits, see alignment E=2.1e-25 PF13508: Acetyltransf_7" amino acids 45 to 120 (76 residues), 44.8 bits, see alignment E=2e-15

Best Hits

Swiss-Prot: 41% identical to ATSE_BACSU: Putative acetyltransferase BSU40680 (yybD) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_4018)

Predicted SEED Role

"GNAT family acetyltransferase YjcF" in subsystem Experimental tye

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FR5 at UniProt or InterPro

Protein Sequence (142 amino acids)

>PP_4018 Acetyltransferase, GNAT family (Pseudomonas putida KT2440)
MNKISVRLADWHKDNADIRRIREAVFVAEQHIPPELEFDSEDQDALHFLALEGDYPIGTA
RLLADGTIGRISVLKDWRGLKVGDALVNAVIVEAQNRDLKQQMLSAQVHATPFYERLGFR
VVSEEFLEAGIPHVDMVRDSRA