Protein Info for PP_4015 in Pseudomonas putida KT2440

Annotation: HflD-like high frequency lysogenization protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04356: DUF489" amino acids 6 to 197 (192 residues), 242.1 bits, see alignment E=2.6e-76

Best Hits

Swiss-Prot: 100% identical to HFLD_PSEPK: High frequency lysogenization protein HflD homolog (hflD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K07153, high frequency lysogenization protein (inferred from 100% identity to ppu:PP_4015)

Predicted SEED Role

"FIG002903: a protein of unknown function perhaps involved in purine metabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FR8 at UniProt or InterPro

Protein Sequence (208 amino acids)

>PP_4015 HflD-like high frequency lysogenization protein (Pseudomonas putida KT2440)
MSNLQEQLIALGGVFQAAVLVDRIARTGQASEANIGCMLGSLLVRDPKDTLEVFGGDDLN
LRDGYRALIGALERDPNSLQREPLRYALSMLGLERQLNKRGDLLDTIGNRLPQIQSQAEH
FGLVHENVIASSGALYQDTLSTLRQRIQVHGDMRFLQQPNNASKIRALLLAGIRAARLWR
QLGGHRWQLVFSRRKLLNELYDMMRSPN