Protein Info for PP_4014 in Pseudomonas putida KT2440

Annotation: tRNA-specific 2-thiouridylase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF02540: NAD_synthase" amino acids 11 to 84 (74 residues), 25.3 bits, see alignment E=2e-09 PF02568: ThiI" amino acids 13 to 95 (83 residues), 24.2 bits, see alignment E=6.1e-09 PF03054: tRNA_Me_trans" amino acids 13 to 207 (195 residues), 272.3 bits, see alignment E=6.3e-85 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 13 to 364 (352 residues), 455.8 bits, see alignment E=4.3e-141 PF20259: tRNA_Me_trans_M" amino acids 213 to 280 (68 residues), 83.1 bits, see alignment E=2e-27 PF20258: tRNA_Me_trans_C" amino acids 290 to 364 (75 residues), 73.2 bits, see alignment E=4.3e-24

Best Hits

Swiss-Prot: 100% identical to MNMA_PSEPK: tRNA-specific 2-thiouridylase MnmA (mnmA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 100% identity to ppf:Pput_1819)

MetaCyc: 68% identical to tRNA-specific 2-thiouridylase (Escherichia coli K-12 substr. MG1655)
RXN0-2023 [EC: 2.8.1.13]

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.- or 2.8.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FR9 at UniProt or InterPro

Protein Sequence (374 amino acids)

>PP_4014 tRNA-specific 2-thiouridylase MnmA (Pseudomonas putida KT2440)
MTSPALKDPAKTRVIVGMSGGVDSSVSALLLIEQGYQVEGLFMKNWEEDDGTEYCTARED
LADAQAVCDRIGIKLHTANFAAEYWDNVFEHFLEEYKAGRTPNPDILCNREIKFKAFLDY
ALSLGADLIATGHYVRRRDTGALTELLKGLDPNKDQSYFLHAVGGQEIARTLFPVGELEK
PEVRAIAEKHGLATAKKKDSTGICFIGERRFSDFLKQYLPAQPGDIETTEGEVIGRHHGL
MYHTIGQRQGLGIGGLKDASDEPWYVLHKDLARNVLVVGQGNEHPWLFSRALLASEIFWV
NPVDLGSPRQLTAKVRYRQSDQRCTLERTASGYRAVFDEPQRAVTPGQSVVFYDGEVCLG
GGVIEAAEPWSPRA