Protein Info for PP_4004 in Pseudomonas putida KT2440

Annotation: DNA translocase FtsK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 834 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 71 to 94 (24 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details PF13491: FtsK_4TM" amino acids 23 to 194 (172 residues), 140.6 bits, see alignment E=8.7e-45 PF17854: FtsK_alpha" amino acids 339 to 439 (101 residues), 112.1 bits, see alignment E=2.7e-36 PF01580: FtsK_SpoIIIE" amino acids 448 to 659 (212 residues), 252.6 bits, see alignment E=5.9e-79 PF09397: FtsK_gamma" amino acids 768 to 828 (61 residues), 91.1 bits, see alignment 6.3e-30

Best Hits

Swiss-Prot: 100% identical to FTSK_PSEPK: DNA translocase FtsK (ftsK) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 100% identity to ppu:PP_4004)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FS8 at UniProt or InterPro

Protein Sequence (834 amino acids)

>PP_4004 DNA translocase FtsK (Pseudomonas putida KT2440)
MKKSTATPAPLPVPLWRQQLHYRLKEGALIAVGALCLYLWMALLTYDTSDPGFSHTSNVD
QVQNAAGRAGAYFADILFMVLGYFAYIFPLLLAVKTWQIFRERHQPWDWSGWLFSWRLIG
LVFLVLSGAALAHIHFHPPASLPFSAGGALGESLGDLARNLLNVQGSTLMFIALFLFGLT
VFTDLSWFKVMDLTGKITLDLFELVQGAATRWWEARNERKRLEAQLREDEPVFKAAPMAA
EKREPAKPSLRERILKREEPPAQPVEPREPTLAREPIVPPRETAPEALAPRETVVPRQQH
AAPTIVPPSAASRAPEPSKRAMKEKQAPLFVDSAVEGTLPSISILDPAEQKKIEYSPESL
AGVGQLLEIKLKEFGVEVAVDSIHPGPVITRYEIQPAAGVKVSRIANLAKDLARSLAVTS
VRVVEVIPGKTTVGIEIPNENRQMVRFSEVLATPQYDEQKSPVTLALGHDIGGKPVITDL
AKMPHLLVAGTTGSGKSVGVNAMILSILFKSSPEDARLIMIDPKMLELSIYEGIPHLLCP
VVTDMKDAANALRWSVAEMERRYKLMAAMGVRNLAGFNRKIKDAQEAGEVIHDPLYRRES
MDDEPPALKTLPTIVVVVDEFADMMMIVGKKVEELIARIAQKARAAGIHLILATQRPSVD
VITGLIKANIPTRMAFQVSSKIDSRTIIDQGGAEQLLGHGDMLYMPPGTSLPIRVHGAFV
SDDEVHRTVEAWKLRGAPDYNDDILNGVEEAGSGFDGGGGGGEGDDAETDALYDEAVQFV
LESRRASISAVQRKLKIGYNRAARMIESMEMAGVVTPMNSNGSREVIAPGGPRD