Protein Info for PP_3972 in Pseudomonas putida KT2440

Annotation: Oxidoreductase, short chain dehydrogenase/reductase family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 360 to 377 (18 residues), see Phobius details amino acids 417 to 435 (19 residues), see Phobius details PF00106: adh_short" amino acids 125 to 312 (188 residues), 151.9 bits, see alignment E=2.3e-48 PF08659: KR" amino acids 127 to 276 (150 residues), 35.6 bits, see alignment E=1.4e-12 PF13561: adh_short_C2" amino acids 131 to 354 (224 residues), 106.9 bits, see alignment E=1.8e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3972)

Predicted SEED Role

"Oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FV6 at UniProt or InterPro

Protein Sequence (441 amino acids)

>PP_3972 Oxidoreductase, short chain dehydrogenase/reductase family (Pseudomonas putida KT2440)
MVDQATGMKSGERYRVENVERAHQFPGFFQDGKYYLGPELLTAVGWLEGTRFIYDSLDAE
GEPVFPNKEAGTVEGLTLTLVDGTALELSLVEADEIIAPFEHRSSGTEQEAPRRGYPVRG
PLRGKVVVITGASSGIGRAAAHAFACKGARLVLAARDEEALFDVLDECTDCGTDAIAVTT
DVTHSDQVQALAAQASAFGHGRIDIWVNNAGVGAVGNFEDTPLEAHEQVIQTDLIGYLRG
AYVALPFFKAQGSGILINTLSLGSWVAQPYAAAYSASKFGLRGLTEALRGELTKFPNIHV
CDIYPAVMDTPGFRDGGNYTGHALTPPSPIYDPERVAKTMVACAISPRAHTTVGTAARLA
HLASYLVPGIALLSGWVTRWGINRSPIAETSSGNLFEPPSDRRSIDGGWRKPKAKTPLLI
GAAALGIIAGLTIACSRRRKH