Protein Info for PP_3955 in Pseudomonas putida KT2440

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 675 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 72 to 89 (18 residues), see Phobius details amino acids 101 to 118 (18 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 298 to 316 (19 residues), see Phobius details amino acids 339 to 357 (19 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 390 to 407 (18 residues), see Phobius details amino acids 412 to 437 (26 residues), see Phobius details amino acids 450 to 479 (30 residues), see Phobius details amino acids 485 to 504 (20 residues), see Phobius details amino acids 510 to 530 (21 residues), see Phobius details amino acids 535 to 556 (22 residues), see Phobius details amino acids 564 to 586 (23 residues), see Phobius details amino acids 600 to 620 (21 residues), see Phobius details amino acids 632 to 664 (33 residues), see Phobius details TIGR02123: TRAP transporter, 4TM/12TM fusion protein" amino acids 16 to 666 (651 residues), 747.4 bits, see alignment E=7.4e-229 PF06808: DctM" amino acids 114 to 376 (263 residues), 207.1 bits, see alignment E=2.2e-65 amino acids 391 to 590 (200 residues), 86.3 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_3955)

Predicted SEED Role

"TRAP transporter, 4TM/12TM fusion protein, unknown substrate 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FX2 at UniProt or InterPro

Protein Sequence (675 amino acids)

>PP_3955 permease (Pseudomonas putida KT2440)
MSDTAQGLHASTDRWPAALFAVALVFSVFQIATAAFPLISTQVLRAIHVGFLLLVVYLSY
SFVGHRRPWQPLAWLLGLAGMATAAYQWYFEGDLIQRSGELTTSDLIVGLLLIGLVFEAA
RRVMGIALPIICALFLAYGLLGQHLPGELAHRGYGLDQIVNQLAFGTEGLYGTPTYVSAT
YIYLFILFGAFLEQAGMIRLFTDFAMGLFGHRSGGPAKVSVFSSALMGTITGSGVANVVT
TGQFTIPLMKRFGYKPAFAGGVEATSSMGSQLMPPVMGAVAFIMAETINVPYAEVAKAAL
IPALLYFGSVYWMVHLEARRSHLHGLPREQCPSAWDALRQRWFLLVPLMVLVALLFSGRT
PLYSGMVGLALTAIVILGSAIILRAQKTWLRAAFWVALGILCSGFFRMGIGVILMVIAGL
AIACCFVQGGRATLHACVMALAEGARHAVPVGIACALVGVIIGVISLTGLATTFAGYILD
LGRDNLFLSLVLTMLTCLVLGMGIPTIPNYIITSSIAAPALLELGVPLIVSHMFVFYFGI
LADLTPPVALACFAAAPIAKEKGLLISFWAVRIALAGFVVPFMAVYDPALMMQGDSMGST
LYMVIKAAFAVALWGCASIGHLRAPMPWWERLLAFAAGVSLILAAPISDEVGFALGAAVL
GWHYWRTRPASGHLA