Protein Info for PP_3954 in Pseudomonas putida KT2440

Annotation: periplasmic binding subunit of unknown solute

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02122: TRAP transporter solute receptor, TAXI family" amino acids 1 to 313 (313 residues), 403.9 bits, see alignment E=2e-125 PF16868: NMT1_3" amino acids 29 to 312 (284 residues), 329.9 bits, see alignment E=2.5e-102 PF12974: Phosphonate-bd" amino acids 72 to 189 (118 residues), 35.2 bits, see alignment E=1.4e-12 PF09084: NMT1" amino acids 115 to 189 (75 residues), 27 bits, see alignment E=6.2e-10

Best Hits

KEGG orthology group: K07080, (no description) (inferred from 100% identity to ppu:PP_3954)

Predicted SEED Role

"TRAP transporter solute receptor, unknown substrate 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FX3 at UniProt or InterPro

Protein Sequence (316 amino acids)

>PP_3954 periplasmic binding subunit of unknown solute (Pseudomonas putida KT2440)
MNPALRLALASTLFAVSAAAQAAPTFINILTGGTSGVYYPVGVGISQIYSHGIEGSKTTV
QATKASVENLNLLQAGRGELAFALGDSVADAWKGDAEAGFKTPLKKLRAIAGTYPNYIQI
VASKESGITSLSDLKGKRISVGAPKSGTELNARAIFKAAGLTYQDMGKVEYLPYAESVEL
IKNRQLDATLQSSGLGQAAIRDLAATLPVVFVPIPAEVVTRIGNNAYQPATIPANTYDGQ
SADVSTAAINNILVTRADIGDDLAYQMTKLIFENLPRLVTAHAAAKDIQAENAAKNLPIP
LHPGAARYFKEKNLLP