Protein Info for PP_3953 in Pseudomonas putida KT2440

Annotation: potassium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 8 to 34 (27 residues), see Phobius details amino acids 40 to 62 (23 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 274 to 297 (24 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 393 to 417 (25 residues), see Phobius details amino acids 428 to 442 (15 residues), see Phobius details amino acids 457 to 482 (26 residues), see Phobius details PF02386: TrkH" amino acids 65 to 478 (414 residues), 182 bits, see alignment E=8.1e-58

Best Hits

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 100% identity to ppu:PP_3953)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88FX4 at UniProt or InterPro

Protein Sequence (484 amino acids)

>PP_3953 potassium transporter (Pseudomonas putida KT2440)
MPLPALRFIAFIIGVFLITLAVSMVIPMLTLLVYDRSDDLGAFVWSSLIVLCVGLLMVAR
GVPDTPQLRTRDMYLLTTASWVIVCAFAALPMVFIRHISYTDAFFETMSGITTTGSTVLT
GLDSASPGLLIWRSLLHWLGGIGFIGMAVAILPLLRVGGMRLFQTESSDWSDKVTPRSHV
AAKIILLVYLGLTALGTGALWAAGMTPFEAINHSMSLVSTGGFSTSDASLGHWEQPAVHW
VAVVIMILGSLPFTLYVATLRGHRGILLKDHQVRGFIGFLVFVWLTVGTWLCLHSNLAWW
DAFRIVAVNVTSVVTTTGIAVGDYTLWGSFAIMLFFYLTFVGGCSGSTAGGLKIFRFQVA
AALLVSSLKQLIHPRATISKKYNGHPIDEEIVRSLLTFSFFFTVTIAVIALGLSLIGLDW
MTALSGAATAVCNVGPGLGTLIGPAGNFASLPDAAKWLLTVGMLLGRLEILTVLVLVSPV
FWRF