Protein Info for PP_3952 in Pseudomonas putida KT2440

Annotation: 3-oxoadipate CoA-transferase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 TIGR02428: 3-oxoacid CoA-transferase, B subunit" amino acids 8 to 211 (204 residues), 294.9 bits, see alignment E=1.3e-92 PF01144: CoA_trans" amino acids 11 to 188 (178 residues), 129 bits, see alignment E=8.5e-42

Best Hits

Swiss-Prot: 100% identical to PCAJ_PSEPU: 3-oxoadipate CoA-transferase subunit B (pcaJ) from Pseudomonas putida

KEGG orthology group: K01032, 3-oxoadipate CoA-transferase, beta subunit [EC: 2.8.3.6] (inferred from 99% identity to ppg:PputGB1_3594)

MetaCyc: 100% identical to beta subunit of beta-ketoadipate succinyl-CoA transferase (Pseudomonas putida)
3-oxoadipate CoA-transferase. [EC: 2.8.3.6]

Predicted SEED Role

"3-oxoadipate CoA-transferase subunit B (EC 2.8.3.6)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 2.8.3.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.6

Use Curated BLAST to search for 2.8.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A101 at UniProt or InterPro

Protein Sequence (213 amino acids)

>PP_3952 3-oxoadipate CoA-transferase subunit A (Pseudomonas putida KT2440)
MTITKKLSRTEMAQRVAADIQEGAYVNLGIGAPTLVANYLGDKEVFLHSENGLLGMGPSP
APGEEDDDLINAGKQHVTLLTGGAFFHHADSFSMMRGGHLDIAVLGAFQVSVKGDLANWH
TGAEGSIPAVGGAMDLATGARQVFVMMDHLTKTGESKLVPECTYPLTGIACVSRIYTDLA
VLEVTPEGLKVVEICADIDFDELQKLSGVPLIK